biounit.RdConstruct biological assemblies/units based on a 'pdb' object.
biounit(pdb, biomat = NULL, multi = FALSE, ncore = NULL)
| pdb | an object of class |
|---|---|
| biomat | a list object as returned by |
| multi | logical, if TRUE the biological unit is returned as a
'multi-model' |
| ncore | number of CPU cores used to do the calculation. By default
( |
a list of pdb objects with each representing an individual
biological unit.
A valid structural/simulation study should be performed on the biological unit of a protein system. For example, the alpha2-beta2 tetramer form of hemoglobin. However, canonical PDB files usually contain the asymmetric unit of the crystal cell, which can be:
One biological unit
A portion of a biological unit
Multiple biological units
The function performs symmetry operations to the coordinates based on the
transformation matrices stored in a 'pdb' object returned by
read.pdb, and returns biological units stored as a list of
pdb objects.
Xin-Qiu Yao
read.pdb
# \donttest{ # PDB server connection required - testing excluded pdb <- read.pdb("2dn1")#> Note: Accessing on-line PDB filebiounit <- biounit(pdb) pdb#> #> Call: read.pdb(file = "2dn1") #> #> Total Models#: 1 #> Total Atoms#: 2506, XYZs#: 7518 Chains#: 2 (values: A B) #> #> Protein Atoms#: 2172 (residues/Calpha atoms#: 285) #> Nucleic acid Atoms#: 0 (residues/phosphate atoms#: 0) #> #> Non-protein/nucleic Atoms#: 334 (residues: 236) #> Non-protein/nucleic resid values: [ HEM (2), HOH (230), MBN (2), OXY (2) ] #> #> Protein sequence: #> LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKK #> VADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAV #> HASLDKFLASVSTVLTSKYRHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRF #> FESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFA...<cut>...HKYH #> #> + attr: atom, xyz, seqres, helix, calpha, #> remark, callbiounit#> $`AUTHOR.determined.tetramer (4 chains)` #> #> Call: biounit(pdb = pdb) #> #> Total Models#: 1 #> Total Atoms#: 5012, XYZs#: 15036 Chains#: 4 (values: A B C D) #> #> Protein Atoms#: 4344 (residues/Calpha atoms#: 570) #> Nucleic acid Atoms#: 0 (residues/phosphate atoms#: 0) #> #> Non-protein/nucleic Atoms#: 668 (residues: 472) #> Non-protein/nucleic resid values: [ HEM (4), HOH (460), MBN (4), OXY (4) ] #> #> Protein sequence: #> LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKK #> VADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAV #> HASLDKFLASVSTVLTSKYRHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRF #> FESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFA...<cut>...HKYH #> #> + attr: atom, helix, sheet, seqres, xyz, #> calpha, call, log #># } if (FALSE) { biounit <- biounit(read.pdb("2bfu"), multi=TRUE) write.pdb(biounit[[1]], file="biounit.pdb") # open the pdb file in VMD to have a look on the biological unit }